NAB2, Mouse, Clone: 4H6, Abnova™

Catalog No.	Quantity
89-123-236	100 μg

Catalog No. 89-123-236 Supplier Abnova Corporation Supplier No. H00004665M01

Description

Mouse monoclonal antibody raised against a partial recombinant NAB2.

This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq

Sequence: DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ

Specifications

• Antigen: NAB2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4H6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NAB2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NAB2
• Gene Accession No.: NM_005967
• Gene Alias: MADER/MGC75085
• Gene Symbols: NAB2
• Host Species: Mouse
• Immunogen: NAB2 (NP_005958.1, 421 a.a. ∼ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4665
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ