NAGLU, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NAGLU.

Supplier:  Abnova Corporation H00004669A01

Catalog No. 89-003-027

Description

This gene encodes an enzyme that degrades heparan sulfate by hydrolysis of terminal N-acetyl-D-glucosamine residues in N-acetyl-alpha-D-glucosaminides. Defects in this gene are the cause of mucopolysaccharidosis type IIIB (MPS-IIIB), also known as Sanfilippo syndrome B. This disease is characterized by the lysosomal accumulation and urinary excretion of heparan sulfate. [provided by RefSeq

Sequence: YQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGS

Specifications

• Antigen: NAGLU
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant NAGLU.
• Gene: NAGLU
• Gene Alias: MPS-IIIB/MPS3B/NAG/UFHSD
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_000263
• Gene Symbols: NAGLU
• Immunogen: NAGLU (NP_000254, 644 a.a. ∼ 742 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 4669
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.