NALP8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233809

Catalog No. NBP233809

Description

NALP8 Polyclonal specifically detects NALP8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NALP8
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q86W28
• Gene Symbols: NLRP8
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EDLNVGETQVNLEEGESGKIRRYKSNVMEKFFPIWDITTWPGNQRDFFYQGVHRHEEYLPCLLLPKRPQGRQPKTVA
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CLR19.2, NACHT, Leucine Rich Repeat And PYD Containing 8, NACHT, LRR And PYD Containing Protein 8, NACHT, LRR And PYD Domains-Containing Protein 8, NALP-8, NLR Family, Pyrin Domain Containing 8, NLRP8, NOD16, Nucleotide-Binding Oligomerization Domain Protein 16, Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And Pyrin Domain Containing 8, PAN4, PYRIN And NACHT-Containing Protein 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 126205
• Target Species: Human
• Isotype: IgG

For Research Use Only