nucleosome assembly protein 1-like 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NAP1L1 protein.

Supplier:  Abnova Corporation H00004673B01

Catalog No. 89-005-821

Description

This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing of this gene results in several transcript variants; however, not all have been fully described. [provided by RefSeq

Sequence: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ

Specifications

• Antigen: nucleosome assembly protein 1-like 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human NAP1L1 protein.
• Gene: NAP1L1
• Gene Alias: FLJ16112/MGC23410/MGC8688/NAP1/NAP1L/NRP
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC002387
• Gene Symbols: NAP1L1
• Immunogen: NAP1L1 (AAH02387, 1 a.a. ∼ 391 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 4673
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.