NAT2, Mouse, Clone: 3B5, Abnova™

Catalog No.	Quantity
89-016-003	100 μg

Catalog No. 89-016-003 Supplier Abnova Corporation Supplier No. H00000010M01

Description

Mouse monoclonal antibody raised against a partial recombinant NAT2.

This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near this gene (NAT2). [provided by RefSeq

Sequence: PPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLE

Specifications

• Antigen: NAT2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3B5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NAT2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NAT2
• Gene Accession No.: BC015878
• Gene Alias: AAC2/PNAT
• Gene Symbols: NAT2
• Host Species: Mouse
• Immunogen: NAT2 (AAH15878, 96 a.a. ∼ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ