NAT2, Mouse, Clone: 3B5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NAT2.

Supplier:  Abnova Corporation H00000010M01

Catalog No. 89-016-003

Description

This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near this gene (NAT2). [provided by RefSeq

Sequence: PPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLE

Specifications

• Antigen: NAT2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC015878
• Gene Symbols: NAT2
• Immunogen: NAT2 (AAH15878, 96 a.a. ∼ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 3B5
• Description: Mouse monoclonal antibody raised against a partial recombinant NAT2.
• Gene: NAT2
• Gene Alias: AAC2/PNAT
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 10
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid