N-acetyltransferase 6 (GCN5-related) (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NAT6 protein.

Supplier:  Abnova Corporation H00024142B01

Catalog No. 89-007-334

Description

Sequence: MELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTGLTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPPKSLLETQYQNVRGRPIFWMEKDI

Specifications

• Antigen: N-acetyltransferase 6 (GCN5-related)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human NAT6 protein.
• Gene: NAT6
• Gene Alias: FUS-2/FUS2
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 24142
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC004483
• Gene Symbols: NAT6
• Immunogen: NAT6 (AAH04483, 23 a.a. ∼ 308 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum