neuroblastoma, suppression of tumorigenicity 1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-882	100 μg

Catalog No. 89-017-882 Supplier Abnova Corporation Supplier No. H00004681D01P

Description

Rabbit polyclonal antibody raised against a full-length human NBL1 protein.

This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED

Specifications

• Antigen: neuroblastoma, suppression of tumorigenicity 1
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human NBL1 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NBL1
• Gene Accession No.: NM_005380
• Gene Alias: D1S1733E/DAN/DAND1/MGC8972/NB/NO3
• Gene Symbols: NBL1
• Host Species: Rabbit
• Immunogen: NBL1 (NP_005371.1, 1 a.a. ∼ 180 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 4681
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG