NBN, Mouse, Clone: 2C7, Abnova™

Catalog No.	Quantity
89-123-238	100 μg

Catalog No. 89-123-238 Supplier Abnova Corporation Supplier No. H00004683M02

Description

Mouse monoclonal antibody raised against a partial recombinant NBN.

Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation. [provided by RefSeq

Sequence: DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR

Specifications

• Antigen: NBN
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2C7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NBN.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NBN
• Gene Accession No.: NM_002485
• Gene Alias: AT-V1/AT-V2/ATV/FLJ10155/MGC87362/NBS/NBS1/P95
• Gene Symbols: NBN
• Host Species: Mouse
• Immunogen: NBN (NP_002476, 645 a.a. ∼ 754 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4683
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ