NCK2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-102	50 μL

Catalog No. 89-003-102 Supplier Abnova Corporation Supplier No. H00008440A01

Description

Mouse polyclonal antibody raised against a partial recombinant NCK2.

This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: LYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALNERGVEGDFLIRD

Specifications

• Antigen: NCK2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NCK2.
• Formulation: 50% glycerol
• Gene: NCK2
• Gene Accession No.: NM_003581
• Gene Alias: GRB4/NCKbeta
• Gene Symbols: NCK2
• Host Species: Mouse
• Immunogen: NCK2 (NP_003572, 203 a.a. ∼ 312 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 8440
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid