nuclear receptor coactivator 4, Mouse, Clone: 1B7, Abnova™

Catalog No.	Quantity
89-001-074	100 μg

Catalog No. 89-001-074 Supplier Abnova Corporation Supplier No. H00008031M04

Description

Mouse monoclonal antibody raised against a partial recombinant NCOA4.

This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq

Sequence: EGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM

Specifications

• Antigen: nuclear receptor coactivator 4
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1B7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NCOA4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NCOA4
• Gene Accession No.: NM_005437
• Gene Alias: ARA70/DKFZp762E1112/ELE1/PTC3/RFG
• Gene Symbols: NCOA4
• Host Species: Mouse
• Immunogen: NCOA4 (NP_005428, 505 a.a. ∼ 614 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8031
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ