nicastrin, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-558	50 μL

Catalog No. 89-004-558 Supplier Abnova Corporation Supplier No. H00023385A01

Description

Mouse polyclonal antibody raised against a partial recombinant NCSTN.

This gene encodes a Type I transmembrane glycoprotein that is an integral component of the multimeric gamma-secretase complex. The encoded protein cleaves integral membrane proteins, including Notch receptors and beta-amyloid precursor protein, and may be a stabilizing cofactor required for gamma-secretase complex assembly. The cleavage of beta-amyloid precursor protein yields amyloid beta peptide, the main component of the neuritic plaque and the hallmark lesion in the brains of patients with Alzheimer's disease; however, the nature of the encoded protein's role in Alzheimer's disease is not known for certain. Alternatively spliced transcript variants have been described, but their full-length nature has not been determined. [provided by RefSeq]

Sequence: VERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFS

Specifications

• Antigen: nicastrin
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NCSTN.
• Formulation: 50% glycerol
• Gene: NCSTN
• Gene Accession No.: BC047621
• Gene Alias: APH2/KIAA0253
• Gene Symbols: NCSTN
• Host Species: Mouse
• Immunogen: NCSTN (AAH47621, 16 a.a. ∼ 115 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 23385
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum