Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000827

necdin homolog (mouse), Mouse, Clone: 2D11, Abnova™

Catalog No. 89000827 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-827 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-827 Supplier Abnova Corporation Supplier No. H00004692M07
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant NDN.

This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq

Sequence: WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED

Specifications

Antigen necdin homolog (mouse)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2D11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NDN.
Formulation PBS with no preservative; pH 7.4
Gene NDN
Gene Accession No. NM_002487
Gene Alias HsT16328/PWCR
Gene Symbols NDN
Host Species Mouse
Immunogen NDN (NP_002478, 222 a.a. ∼ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 4692
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.