NDRG2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-159	50 μL

Catalog No. 89-003-159 Supplier Abnova Corporation Supplier No. H00057447A01

Description

Mouse polyclonal antibody raised against a partial recombinant NDRG2.

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq

Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP

Specifications

• Antigen: NDRG2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NDRG2.
• Formulation: 50% glycerol
• Gene: NDRG2
• Gene Accession No.: NM_016250
• Gene Alias: DKFZp781G1938/FLJ25522/KIAA1248/SYLD
• Gene Symbols: NDRG2
• Host Species: Mouse
• Immunogen: NDRG2 (NP_057334, 1 a.a. ∼ 96 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 57447
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid