NDUFA1, Mouse, Clone: 2A4, Abnova™

Catalog No.	Quantity
89-123-239	100 μg

Catalog No. 89-123-239 Supplier Abnova Corporation Supplier No. H00004694M10

Description

Mouse monoclonal antibody raised against a full-length recombinant NDUFA1.

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the hydrophobic protein (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq]

Sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

Specifications

• Antigen: NDUFA1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2A4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant NDUFA1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NDUFA1
• Gene Accession No.: BC000266
• Gene Alias: CI-MWFE/MWFE/ZNF183
• Gene Symbols: NDUFA1
• Host Species: Mouse
• Immunogen: NDUFA1 (AAH00266, 1 a.a. ∼ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4694
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ