Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NDUFA3, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NDUFA3 protein.

Supplier:  Abnova Corporation H00004696B01P

Catalog No. 89-002-572


Only null left
Add to Cart

Description

Description

Sequence: MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
Specifications

Specifications

NDUFA3
Polyclonal
Mouse polyclonal antibody raised against a full-length human NDUFA3 protein.
NDUFA3
B9
Mouse
Affinity chromatography
RUO
4696
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Purified
Western Blot
Unconjugated
PBS with no preservative; pH 7.4
NM_004542.1
NDUFA3
NDUFA3 (NP_004533.1, 1 a.a. ∼ 84 a.a) full-length human protein.
50 μg
Primary
Human
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.