Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123240

NDUFA8, Mouse, Clone: 2E10, Abnova™

Catalog No. 89123240 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-240 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-240 Supplier Abnova Corporation Supplier No. H00004702M05
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant NDUFA8.

The protein encoded by this gene belongs to the complex I 19kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq

Sequence: MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR

Specifications

Antigen NDUFA8
Applications ELISA, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 2E10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NDUFA8.
Formulation PBS with no preservative; pH 7.4
Gene NDUFA8
Gene Accession No. NM_014222
Gene Alias CI-19KD/CI-PGIV/MGC793/PGIV
Gene Symbols NDUFA8
Host Species Mouse
Immunogen NDUFA8 (NP_055037.1, 1 a.a. ∼ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4702
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.