NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa, Mouse, Clone: 1D6, Abnova™

Catalog No.	Quantity
89-001-298	100 μg

Catalog No. 89-001-298 Supplier Abnova Corporation Supplier No. H00054539M12

Description

Mouse monoclonal antibody raised against a full-length recombinant NDUFB11.

NDUFB11 is a component of mitochondrial complex I. Complex I catalyzes the first step in the electron transport chain, the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane (Carroll et al., 2002 [PubMed 12381726]).[supplied by OMIM

Sequence: MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE

Specifications

• Antigen: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1D6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant NDUFB11.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NDUFB11
• Gene Accession No.: BC010665
• Gene Alias: ESSS/FLJ20494/MGC111182/NP17.3/Np15/P17.3
• Gene Symbols: NDUFB11
• Host Species: Mouse
• Immunogen: NDUFB11 (AAH10665, 1 a.a. ∼ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 54539
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ