Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89017887

NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89017887 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-017-887 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-017-887 Supplier Abnova Corporation Supplier No. H00004709D01P
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against a full-length human NDUFB3 protein.

The multisubunit NADH:ubiquinone oxidoreductase (complex I) is the first enzyme complex in the electron transport chain of mitochondria. See NDUFA2 (MIM 602137).[supplied by OMIM

Sequence: MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH

Specifications

Antigen NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against a full-length human NDUFB3 protein.
Formulation PBS with no preservative; pH 7.4
Gene NDUFB3
Gene Accession No. NM_002491.1
Gene Alias B12
Gene Symbols NDUFB3
Host Species Rabbit
Immunogen NDUFB3 (NP_002482.1, 1 a.a. ∼ 98 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4709
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.