NDUFS4, Mouse, Clone: 3A4, Abnova™

Catalog No.	Quantity
89-123-106	200 μL

Catalog No. 89-123-106 Supplier Abnova Corporation Supplier No. H00004724M02A

Description

Mouse monoclonal antibody raised against a full-length recombinant NDUFS4.

This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes. [provided by RefSeq

Sequence: MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Specifications

• Antigen: NDUFS4
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3A4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant NDUFS4.
• Formulation: ascites with no preservative
• Gene: NDUFS4
• Gene Accession No.: BC005270
• Gene Alias: AQDQ
• Gene Symbols: NDUFS4
• Host Species: Mouse
• Immunogen: NDUFS4 (AAH05270, 1 a.a. ∼ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4724
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ