NDUFS4, Mouse, Clone: 3F11, Abnova™

Catalog No.	Quantity
89-123-241	100 μg

Catalog No. 89-123-241 Supplier Abnova Corporation Supplier No. H00004724M03

Description

Mouse monoclonal antibody raised against a partial recombinant NDUFS4.

This gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes. [provided by RefSeq

Sequence: GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Specifications

• Antigen: NDUFS4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3F11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NDUFS4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NDUFS4
• Gene Accession No.: NM_002495
• Gene Alias: AQDQ
• Gene Symbols: NDUFS4
• Host Species: Mouse
• Immunogen: NDUFS4 (NP_002486, 66 a.a. ∼ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4724
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ