NDUFS7, Mouse, Clone: 3A3, Abnova™

Catalog No.	Quantity
89-002-662	100 μg

Catalog No. 89-002-662 Supplier Abnova Corporation Supplier No. H00374291M01

Description

Mouse monoclonal antibody raised against a partial recombinant NDUFS7.

This gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions. [provided by RefSeq

Sequence: PRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR

Specifications

• Antigen: NDUFS7
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3A3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NDUFS7.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NDUFS7
• Gene Accession No.: NM_024407
• Gene Alias: CI-20KD/FLJ45860/FLJ46880/MGC120002/MY017/PSST
• Gene Symbols: NDUFS7
• Host Species: Mouse
• Immunogen: NDUFS7 (NP_077718, 114 a.a. ∼ 213 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 374291
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ