NDUFV3, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-002-951	100 μg

Catalog No. 89-002-951 Supplier Abnova Corporation Supplier No. H00004731D01P

Description

Rabbit polyclonal antibody raised against a full-length human NDUFV3 protein.

The protein encoded by this gene is one of at least forty-one subunits that make up the NADH-ubiquinone oxidoreductase complex. This complex is part of the mitochondrial respiratory chain and serves to catalyze the rotenone-sensitive oxidation of NADH and the reduction of ubiquinone. The encoded protein is one of three proteins found in the flavoprotein fraction of the complex. The specific function of the encoded protein is unknown. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH

Specifications

• Antigen: NDUFV3
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human NDUFV3 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NDUFV3
• Gene Accession No.: NM_001001503.1
• Gene Alias: CI-9KD
• Gene Symbols: NDUFV3
• Host Species: Rabbit
• Immunogen: NDUFV3 (NP_001001503.1, 1 a.a. ∼ 108 a.a) full-length human protein.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4731
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG