Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

neural precursor cell expressed, developmentally down-regulated 4-like, Mouse, Clone: 1D2, Abnova™

Catalog No. 89001225 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-225 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-225 Supplier Abnova Corporation Supplier No. H00023327M04
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant NEDD4L.

Sequence: MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT

Specifications

Antigen neural precursor cell expressed, developmentally down-regulated 4-like
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1D2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NEDD4L.
Formulation PBS with no preservative; pH 7.4
Gene NEDD4L
Gene Accession No. BC032597
Gene Alias FLJ33870/KIAA0439/NEDD4-2/RSP5/hNedd4-2
Gene Symbols NEDD4L
Host Species Mouse
Immunogen NEDD4L (AAH32597, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 23327
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.