Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000829

sialidase 2 (cytosolic sialidase), Mouse, Clone: 2E5, Abnova™

Catalog No. 89000829 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-829 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-829 Supplier Abnova Corporation Supplier No. H00004759M04
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant NEU2.

This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. [provided by RefSeq

Sequence: AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP

Specifications

Antigen sialidase 2 (cytosolic sialidase)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2E5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NEU2.
Formulation PBS with no preservative; pH 7.4
Gene NEU2
Gene Accession No. NM_005383
Gene Alias MGC129579/SIAL2
Gene Symbols NEU2
Host Species Mouse
Immunogen NEU2 (NP_005374, 180 a.a. ∼ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 4759
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a λ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.