sialidase 2 (cytosolic sialidase), Mouse, Clone: 2E5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NEU2.

Supplier:  Abnova Corporation H00004759M04

Catalog No. 89-000-829

Description

This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. [provided by RefSeq

Sequence: AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP

Specifications

• Antigen: sialidase 2 (cytosolic sialidase)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005383
• Gene Symbols: NEU2
• Immunogen: NEU2 (NP_005374, 180 a.a. ∼ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 4759
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a λ

• Applications: ELISA, Western Blot
• Clone: 2E5
• Description: Mouse monoclonal antibody raised against a partial recombinant NEU2.
• Gene: NEU2
• Gene Alias: MGC129579/SIAL2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody