neurogenic differentiation 6, Mouse, Clone: 3B3, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant NEUROD6.

Supplier:  Abnova Corporation H00063974M06

Catalog No. 89-001-338

Description

NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]).[supplied by OMIM

Sequence: GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMH

Specifications

• Antigen: neurogenic differentiation 6
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_022728
• Gene Symbols: NEUROD6
• Immunogen: NEUROD6 (NP_073565.2, 191 a.a. ∼ 290 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 63974
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 3B3
• Description: Mouse monoclonal antibody raised against a full length recombinant NEUROD6.
• Gene: NEUROD6
• Gene Alias: Atoh2/MATH2/Math-2/NEX1M/bHLHa2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody