Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001337

neurogenin 2, Mouse, Clone: 2A8, Abnova™

Catalog No. 89001337 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-337 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-337 Supplier Abnova Corporation Supplier No. H00063973M10
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant NEUROG2.

Neurogenin-2 is a member of the neurogenin subfamily of basic helix-loop-helix (bHLH) transcription factor genes that play an important role in neurogenesis from migratory neural crest cells.[supplied by OMIM

Sequence: CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG

Specifications

Antigen neurogenin 2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2A8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant NEUROG2.
Formulation PBS with no preservative; pH 7.4
Gene NEUROG2
Gene Accession No. NM_024019
Gene Alias Atoh4/MGC46562/Math4A/NGN2/bHLHa8/ngn-2
Gene Symbols NEUROG2
Host Species Mouse
Immunogen NEUROG2 (NP_076924, 74 a.a. ∼ 175 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 63973
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.