neurofascin homolog (chicken), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-555	50 μL

Catalog No. 89-004-555 Supplier Abnova Corporation Supplier No. H00023114A01

Description

Mouse polyclonal antibody raised against a partial recombinant NFASC.

This gene encodes an L1 family immunoglobulin cell adhesion molecule with multiple IGcam and fibronectin domains. The protein functions in neurite outgrowth, neurite fasciculation, and organization of the axon initial segment (AIS) and nodes of Ranvier on axons during early development. Both the AIS and nodes of Ranvier contain high densities of voltage-gated Na+ (Nav) channels which are clustered by interactions with cytoskeletal and scaffolding proteins including this protein, gliomedin, ankyrin 3 (ankyrin-G), and betaIV spectrin. This protein links the AIS extracellular matrix to the intracellular cytoskeleton. This gene undergoes extensive alternative splicing, and the full-length nature of some variants has not been determined

Sequence: KDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNS

Specifications

• Antigen: neurofascin homolog (chicken)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NFASC.
• Formulation: 50% glycerol
• Gene: NFASC
• Gene Accession No.: NM_001005388
• Gene Alias: DKFZp686P2250/FLJ46866/KIAA0756/NF/NRCAML
• Gene Symbols: NFASC
• Host Species: Mouse
• Immunogen: NFASC (NP_001005388, 661 a.a. ∼ 758 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Cell Adhesion
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 23114
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum