NFAT5, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-126	50 μL

Catalog No. 89-003-126 Supplier Abnova Corporation Supplier No. H00010725A01

Description

Mouse polyclonal antibody raised against a partial recombinant NFAT5.

The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: FHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF

Specifications

• Antigen: NFAT5
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NFAT5.
• Formulation: 50% glycerol
• Gene: NFAT5
• Gene Accession No.: NM_006599
• Gene Alias: KIAA0827/NF-AT5/NFATL1/NFATZ/OREBP/TONEBP
• Gene Symbols: NFAT5
• Host Species: Mouse
• Immunogen: NFAT5 (NP_006590, 1422 a.a. ∼ 1531 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10725
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid