nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NFATC1.

Supplier:  Abnova Corporation H00004772A01

Catalog No. 89-018-827

Description

The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Five transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes. [provided by RefSeq

Sequence: IKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDVPRPVATH

Specifications

• Antigen: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant NFATC1.
• Gene: NFATC1
• Gene Alias: MGC138448/NF-ATC/NFAT2/NFATc
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Gene ID (Entrez): 4772
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006162
• Gene Symbols: NFATC1
• Immunogen: NFATC1 (NP_006153, 701 a.a. ∼ 810 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum