NFATC2, Mouse, Clone: 2A4, Abnova™

Catalog No.	Quantity
89-123-108	200 μL

Catalog No. 89-123-108 Supplier Abnova Corporation Supplier No. H00004773M01A

Description

Mouse monoclonal antibody raised against a partial recombinant NFATC2.

This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: HYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTRLSWIQNIL

Specifications

• Antigen: NFATC2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2A4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NFATC2.
• Formulation: ascites with no preservative
• Gene: NFATC2
• Gene Accession No.: NM_012340
• Gene Alias: KIAA0611/NFAT1/NFATP
• Gene Symbols: NFATC2
• Host Species: Mouse
• Immunogen: NFATC2 (NP_036472, 812 a.a. ∼ 921 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4773
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ