NFATC3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-044	50 μL

Catalog No. 89-003-044 Supplier Abnova Corporation Supplier No. H00004775A01

Description

Mouse polyclonal antibody raised against a partial recombinant NFATC3.

The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL

Specifications

• Antigen: NFATC3
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NFATC3.
• Formulation: 50% glycerol
• Gene: NFATC3
• Gene Accession No.: NM_173165
• Gene Alias: NFAT4/NFATX
• Gene Symbols: NFATC3
• Host Species: Mouse
• Immunogen: NFATC3 (NP_775188, 70 a.a. ∼ 149 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4775
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid