Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014327

neuroglobin, Mouse, Clone: 2B5-A7, Abnova™

Catalog No. 89014327 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-327 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-327 Supplier Abnova Corporation Supplier No. H00058157M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant NGB.

This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions. [provided by RefSeq

Sequence: MERPEPELIRQSWRAVSRSPLGHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Specifications

Antigen neuroglobin
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2B5-A7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant NGB.
Formulation PBS with no preservative; pH 7.4
Gene NGB
Gene Accession No. BC032509
Gene Symbols NGB
Host Species Mouse
Immunogen NGB (AAH32509, 1 a.a. ∼ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 58157
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.