nescient helix loop helix 2, Mouse, Clone: 3D5, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant NHLH2.

Supplier:  Abnova Corporation H00004808M02

Catalog No. 89-000-838

Description

Sequence: SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATR ERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Specifications

• Antigen: nescient helix loop helix 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005599
• Gene Symbols: NHLH2
• Immunogen: NHLH2 (NP_005590, 36 a.a. ∼ 135 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 4808
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 3D5
• Description: Mouse monoclonal antibody raised against a full length recombinant NHLH2.
• Gene: NHLH2
• Gene Alias: HEN2/KIAA0490/NSCL2/bHLHa34
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody