Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NIP7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP231801
Description
NIP7 Polyclonal specifically detects NIP7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NIP7 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q9Y221 | |
NIP7 | |
This antibody was developed against a recombinant protein corresponding to amino acids: ETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYL | |
0.1 mL | |
Core ESC Like Genes, Stem Cell Markers | |
51388 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CGI-37,60S ribosome subunit biogenesis protein NIP7 homolog, HSPC031, KD93FLJ10296, nuclear import 7 homolog (S. cerevisiae) | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction