NK2 transcription factor related, locus 5 (Drosophila), Mouse, Clone: 3A7, Abnova™

Catalog No.	Quantity
89-000-598	100 μg

Catalog No. 89-000-598 Supplier Abnova Corporation Supplier No. H00001482M03

Description

Mouse monoclonal antibody raised against a full-length recombinant NKX2-5.

Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM

Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNA*

Specifications

• Antigen: NK2 transcription factor related, locus 5 (Drosophila)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3A7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant NKX2-5.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NKX2-5
• Gene Accession No.: NM_004387
• Gene Alias: CHNG5/CSX/CSX1/NKX2.5/NKX2E/NKX4-1
• Gene Symbols: NKX2-5
• Host Species: Mouse
• Immunogen: NKX2-5 (NP_004378, 1 a.a. ∼ 130 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1482
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ