Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000840

NK6 homeobox 1, Mouse, Clone: 1B7, Abnova™

Catalog No. 89000840 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-840 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-840 Supplier Abnova Corporation Supplier No. H00004825M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant NKX6-1.

In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].[supplied by OMIM

Sequence: PKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGM*

Specifications

Antigen NK6 homeobox 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1B7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant NKX6-1.
Formulation PBS with no preservative; pH 7.4
Gene NKX6-1
Gene Accession No. NM_006168
Gene Alias NKX6.1/NKX6A
Gene Symbols NKX6-1
Host Species Mouse
Immunogen NKX6-1 (NP_006159, 191 a.a. ∼ 275 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 4825
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.