Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NLGN1, Mouse, Clone: 1D6, Abnova™

Catalog No. 89002791 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-791 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-791 Supplier Abnova Corporation Supplier No. H00022871M03
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant NLGN1.

This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. [provided by RefSeq

Sequence: YSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELS

Specifications

Antigen NLGN1,
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1D6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NLGN1.
Formulation PBS with no preservative; pH 7.4
Gene NLGN1
Gene Accession No. NM_014932
Gene Alias KIAA1070/MGC45115
Gene Symbols NLGN1
Host Species Mouse
Immunogen NLGN1 (NP_055747, 578 a.a. ∼ 677 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 22871
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.