Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014281

neuroligin 4, Y-linked, Mouse, Clone: 1E4, Abnova™

Catalog No. 89014281 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-281 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-281 Supplier Abnova Corporation Supplier No. H00022829M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant NLGN4Y.

Neuroligins, such as NLGN4Y, are cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses (Jamain et al., 2003 [PubMed 12669065]).[supplied by OMIM

Sequence: MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF

Specifications

Antigen neuroligin 4, Y-linked
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1E4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant NLGN4Y.
Formulation PBS with no preservative; pH 7.4
Gene NLGN4Y
Gene Accession No. BC032567
Gene Alias KIAA0951
Gene Symbols NLGN4Y
Host Species Mouse
Immunogen NLGN4Y (AAH32567, 1 a.a. ∼ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Adhesion
Primary or Secondary Primary
Gene ID (Entrez) 22829
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.