neuroligin 4, Y-linked, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human NLGN4Y protein.

Supplier:  Abnova Corporation H00022829D01P

Catalog No. 89-018-084

Description

Neuroligins, such as NLGN4Y, are cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses (Jamain et al., 2003 [PubMed 12669065]).[supplied by OMIM

Sequence: MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF

Specifications

• Antigen: neuroligin 4, Y-linked
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human NLGN4Y protein.
• Gene: NLGN4Y
• Gene Alias: KIAA0951
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: ENST00000297967
• Gene Symbols: NLGN4Y
• Immunogen: NLGN4Y (ENSP00000297967, 1 a.a. ∼ 134 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Cell Adhesion
• Gene ID (Entrez): 22829
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG