N-myc (and STAT) interactor, Mouse, Clone: 9B8, Abnova™

Catalog No.	Quantity
89-001-114	100 μg

Catalog No. 89-001-114 Supplier Abnova Corporation Supplier No. H00009111M03

Description

Mouse monoclonal antibody raised against a partial recombinant NMI.

NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq

Sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI

Specifications

• Antigen: N-myc (and STAT) interactor
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 9B8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NMI.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NMI
• Gene Accession No.: BC001268
• Gene Symbols: NMI
• Host Species: Mouse
• Immunogen: NMI (AAH01268, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9111
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ