nicotinamide nucleotide adenylyltransferase 3, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NMNAT3 protein.

Supplier:  Abnova Corporation H00349565B01P

Catalog No. 89-016-644

Description

The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD (Zhang et al., 2003 [PubMed 12574164]).[supplied by OMIM

Sequence: MYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS

Specifications

• Antigen: nicotinamide nucleotide adenylyltransferase 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human NMNAT3 protein.
• Gene: NMNAT3
• Gene Alias: PNAT-3/PNAT3
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 349565
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_178177.2
• Gene Symbols: NMNAT3
• Immunogen: NMNAT3 (NP_835471.1, 1 a.a. ∼ 215 a.a) full-length human protein.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody