neuromedin U, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human NMU protein.

Manufacturer: Abnova Corporation H00010874B02P

Catalog No. 89-017-015

  Check Availability
Add to Cart

    Specifications

    Antigen neuromedin U
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human
    Description neuromedin U
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene NMU
    Gene Accession No. NM_006681
    Gene Symbols NMU
    Host Species Mouse
    Immunogen NMU (NP_006672, 1 a.a. ∽174 a.a) full-length human protein.
    Purification Method Protein A column
    Quantity 50μg
    Regulatory Status RUO
    Research Discipline Neurobiology
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 10874

    Sequence: MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit