Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

non-muscle heavy chain 10 Myosin Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155146

Catalog No. NBP155146


Add to cart

Description

Description

non-muscle heavy chain 10 Myosin Polyclonal antibody specifically detects non-muscle heavy chain 10 Myosin in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

non-muscle heavy chain 10 Myosin
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
MYH10
Synthetic peptides corresponding to MYH10(myosin, heavy chain 10, non-muscle) The peptide sequence was selected from the N terminal of MYH10. Peptide sequence WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD.
229 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
P35580
Cellular myosin heavy chain, type B, cellular myosin heavy chain, type B type B, heavy polypeptide 10, non-muscle, MGC134913, MGC134914, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, myosin heavy chain, nonmuscle type B, myosin, heavy chain 10, non-muscle, myosin-10, near to the ATP binding region, NMMHC II-b, NMMHCB, NMMHC-B, NMMHC-IIB, Non-muscle myosin heavy chain B, nonmuscle myosin heavy chain IIB, Non-muscle myosin heavy chain IIb, nonmuscle myosin heavy chain-B, nonmuscle myosin II heavy chain-B
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
4628
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only