Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004216

nitric oxide synthase 1 (neuronal), Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004216 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-216 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-216 Supplier Abnova Corporation Supplier No. H00004842A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant NOS1.

Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. This gene encodes a nitric oxide synthase which is highly expressed in skeletal muscle. Genetic variations in this gene are associated with infantile hypertrophic pyloric stenosis type 1

Sequence: FPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPT

Specifications

Antigen nitric oxide synthase 1 (neuronal)
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant NOS1.
Formulation 50% glycerol
Gene NOS1
Gene Accession No. NM_000620
Gene Alias IHPS1/NOS/nNOS
Gene Symbols NOS1
Host Species Mouse
Immunogen NOS1 (NP_000611, 1041 a.a. ∼ 1150 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 4842
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.