nitric oxide synthase 2, inducible, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NOS2A.

Supplier:  Abnova Corporation H00004843A01

Catalog No. 89-018-829

Description

Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq

Sequence: DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG

Specifications

• Antigen: nitric oxide synthase 2, inducible
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant NOS2A.
• Gene: NOS2
• Gene Alias: HEP-NOS/INOS/NOS/NOS2A
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_000625
• Gene Symbols: NOS2
• Immunogen: NOS2A (NP_000616, 685 a.a. ∼ 794 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 4843
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.