Notch homolog 2 (Drosophila), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-830	50 μL

Catalog No. 89-018-830 Supplier Abnova Corporation Supplier No. H00004853A01

Description

Mouse polyclonal antibody raised against a partial recombinant NOTCH2.

This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. [provided by RefSeq

Sequence: QCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVG

Specifications

• Antigen: Notch homolog 2 (Drosophila)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NOTCH2.
• Formulation: 50% glycerol
• Gene: NOTCH2
• Gene Accession No.: NM_024408
• Gene Alias: AGS2/hN2
• Gene Symbols: NOTCH2
• Host Species: Mouse
• Immunogen: NOTCH2 (NP_077719, 27 a.a. ∼ 136 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Gene ID (Entrez): 4853
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum