Notch homolog 3 (Drosophila), Mouse, Clone: 2E2, Abnova™

Catalog No.	Quantity
89-000-845	100 μg

Catalog No. 89-000-845 Supplier Abnova Corporation Supplier No. H00004854M02

Description

Mouse monoclonal antibody raised against a partial recombinant NOTCH3.

This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL). [provided by RefSeq

Sequence: SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR

Specifications

• Antigen: Notch homolog 3 (Drosophila)
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2E2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NOTCH3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NOTCH3
• Gene Accession No.: NM_000435
• Gene Alias: CADASIL/CASIL
• Gene Symbols: NOTCH3
• Host Species: Mouse
• Immunogen: NOTCH3 (NP_000426, 47 a.a. ∼ 156 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4854
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ