nucleoside phosphorylase, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-217	50 μL

Catalog No. 89-004-217 Supplier Abnova Corporation Supplier No. H00004860A01

Description

Mouse polyclonal antibody raised against a partial recombinant NP.

This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq

Sequence: ALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIP

Specifications

• Antigen: nucleoside phosphorylase
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant NP.
• Formulation: 50% glycerol
• Gene: NP
• Gene Accession No.: NM_000270
• Gene Alias: FLJ94043/FLJ97288/FLJ97312/MGC117396/MGC125915/MGC125916/PNP/PRO1837/PUNP
• Gene Symbols: NP
• Host Species: Mouse
• Immunogen: NP (NP_000261, 174 a.a. ∼ 283 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4860
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum