Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89002773

NPC2, Mouse, Clone: 1F4, Abnova™

Catalog No. 89002773 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-773 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-773 Supplier Abnova Corporation Supplier No. H00010577M11
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant NPC2.

This gene encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy. [provided by RefSeq

Sequence: GQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

Specifications

Antigen NPC2
Applications ELISA, Immunoprecipitation
Classification Monoclonal
Clone 1F4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NPC2.
Formulation PBS with no preservative; pH 7.4
Gene NPC2
Gene Accession No. NM_006432
Gene Alias HE1/MGC1333/NP-C2
Gene Symbols NPC2
Host Species Mouse
Immunogen NPC2 (NP_006423.1, 52 a.a. ∼ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10577
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.