natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NPR3.

Supplier:  Abnova Corporation H00004883A01

Catalog No. 89-004-218

Description

The family of natriuretic peptides (see MIM 108780) elicit a number of vascular, renal, and endocrine effects that are important in the maintenance of blood pressure and extracellular fluid volume. These effects are mediated by specific binding of the peptides to cell surface receptors in the vasculature, kidney, adrenal, and brain.[supplied by OMIM

Sequence: RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA

Specifications

• Antigen: natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant NPR3.
• Gene: NPR3
• Gene Alias: ANPRC/GUCY2B/NPRC
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_000908
• Gene Symbols: NPR3
• Immunogen: NPR3 (NP_000899, 42 a.a. ∼ 140 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 4883
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.