Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NPR3.

Manufacturer:  Abnova Corporation H00004883A01

Catalog No. 89-004-218


Add to cart

Description

Description

The family of natriuretic peptides (see MIM 108780) elicit a number of vascular, renal, and endocrine effects that are important in the maintenance of blood pressure and extracellular fluid volume. These effects are mediated by specific binding of the peptides to cell surface receptors in the vasculature, kidney, adrenal, and brain.[supplied by OMIM

Sequence: RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA
Specifications

Specifications

natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C)
Unconjugated
50% glycerol
NM_000908
ANPRC|GUCY2B|NPRC
Mouse
50 uL
Membrane Receptors
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant NPR3.
NPR3
Serum
NPR3
NPR3 (NP_000899, 42 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
4883
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit