natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant NPR3.

Manufacturer:  Abnova Corporation H00004883A01

Catalog No. 89-004-218

Description

The family of natriuretic peptides (see MIM 108780) elicit a number of vascular, renal, and endocrine effects that are important in the maintenance of blood pressure and extracellular fluid volume. These effects are mediated by specific binding of the peptides to cell surface receptors in the vasculature, kidney, adrenal, and brain.[supplied by OMIM

Sequence: RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA

Specifications

• Antigen: natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C)
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_000908
• Gene Alias: ANPRC|GUCY2B|NPRC
• Host Species: Mouse
• Quantity: 50 uL
• Research Discipline: Membrane Receptors
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant NPR3.
• Gene: NPR3
• Format: Serum
• Gene Symbols: NPR3
• Immunogen: NPR3 (NP_000899, 42 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 4883